PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G50480.1
Common NameMBA10.3, NFYC6, NF-YC6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NF-YC
Protein Properties Length: 202aa    MW: 22009.5 Da    PI: 4.3431
Description nuclear factor Y, subunit C6
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G50480.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC174.88.7e-55351341100
        NF-YC   1 qlksfwekqiekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98 
                  ql+++w++q+e+++dfkn++lPlarikki+kad+dv+m+saeaP++++kace+fi++lt+rswl+aeenkr+tl+ksdi++av++++++dfl+d+vp+
  AT5G50480.1  35 QLRNYWIEQMETVSDFKNRQLPLARIKKIMKADPDVHMVSAEAPIIFAKACEMFIVDLTMRSWLKAEENKRHTLQKSDISNAVASSFTYDFLLDVVPK 132
                  89************************************************************************************************ PP

        NF-YC  99 de 100
                  de
  AT5G50480.1 133 DE 134
                  97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471137.21E-324126IPR009072Histone-fold
PfamPF008084.7E-1954117IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.104.2E-3355132IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MAENNNNNGD NMNNDNHQQP PSYSQLPPMA SSNPQLRNYW IEQMETVSDF KNRQLPLARI  60
KKIMKADPDV HMVSAEAPII FAKACEMFIV DLTMRSWLKA EENKRHTLQK SDISNAVASS  120
FTYDFLLDVV PKDESIATAD PGFVAMPHPD GGGVPQYYYP PGVVMGTPMV GSGMYAPSQA  180
WPAAAGDGED DAEDNGGNGG GN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_C6e-373613219119HapE
4g92_C6e-373613219119HapE
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.297280.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453590860.0
Genevisible248504_at0.0
Expression AtlasAT5G50480-
AtGenExpressAT5G50480-
ATTED-IIAT5G50480-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}.
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G50480.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G09030, AT1G17590, AT1G21970, AT1G30500, AT1G72830
IntActSearch Q9FGP7
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G50480
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0256190.0AB025619.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MBA10.
GenBankBT0147830.0BT014783.1 Arabidopsis thaliana At5g50480 gene, complete cds.
GenBankBT0150060.0BT015006.1 Arabidopsis thaliana At5g50480 mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199859.11e-150nuclear transcription factor Y subunit C-6
SwissprotQ9FGP71e-152NFYC6_ARATH; Nuclear transcription factor Y subunit C-6
TrEMBLC0SVT21e-150C0SVT2_ARATH; Putative uncharacterized protein At5g50480 (Fragment)
STRINGAT5G50480.11e-149(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47828160
Representative plantOGRP31517117
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Gusmaroli G,Tonelli C,Mantovani R
    Regulation of the CCAAT-Binding NF-Y subunits in Arabidopsis thaliana.
    Gene, 2001. 264(2): p. 173-85
    [PMID:11250072]
  3. Gusmaroli G,Tonelli C,Mantovani R
    Regulation of novel members of the Arabidopsis thaliana CCAAT-binding nuclear factor Y subunits.
    Gene, 2002. 283(1-2): p. 41-8
    [PMID:11867211]
  4. Wenkel S, et al.
    CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis.
    Plant Cell, 2006. 18(11): p. 2971-84
    [PMID:17138697]
  5. Hackenberg D, et al.
    Studies on differential nuclear translocation mechanism and assembly of the three subunits of the Arabidopsis thaliana transcription factor NF-Y.
    Mol Plant, 2012. 5(4): p. 876-88
    [PMID:22199235]
  6. Calvenzani V, et al.
    Interactions and CCAAT-binding of Arabidopsis thaliana NF-Y subunits.
    PLoS ONE, 2012. 7(8): p. e42902
    [PMID:22912760]